PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G01750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 149aa    MW: 16108.1 Da    PI: 10.2077
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G01750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.47.4e-142685463
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      ++ +r+ +NRe+ArrsR+RK++++eeL  +++ L+aeN +   ++  +  e +k++ e+
  OPUNC05G01750.1 26 ERKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARVEAQIGAYAGELSKVDGEN 85
                     46789999*********************************9999999998888877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-172387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.32588IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.1E-112580No hitNo description
PfamPF001708.3E-102781IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-102779No hitNo description
PROSITE patternPS0003603045IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MSSPSRRSSS PESNTSGGGG GYAADERKRK RMLSNRESAR RSRARKQQRL EELIAEAARL  60
QAENARVEAQ IGAYAGELSK VDGENAVLRA RHGELAGRLQ ALGGVLEIFQ VAGAPVDIPE  120
IPDPLLRPWQ PPFTAQPIVA TAMADAFQF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13946RRSRARKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8336730.0CT833673.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA102G21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639544.14e-77PREDICTED: ocs element-binding factor 1
TrEMBLA0A0E0KY131e-103A0A0E0KY13_ORYPU; Uncharacterized protein
STRINGBGIOSGA019116-PA1e-76(Oryza sativa Indica Group)
STRINGLOC_Os05g03860.11e-76(Oryza sativa Japonica Group)
STRINGLOC_Os05g03865.11e-76(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.14e-26basic region/leucine zipper motif 53